PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Thhalv10028403m
Common NameEUTSA_v10028403mg
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; malvids; Brassicales; Brassicaceae; Eutremeae; Eutrema
Family HB-other
Protein Properties Length: 920aa    MW: 102023 Da    PI: 9.0063
Description HB-other family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Thhalv10028403mgenomeJGIView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1Homeobox18.33.9e-0667123157
                      TT--SS--HHHHHHHHHHHHHSSS--HHHHHHHHHHCTS-HHHHHHHHHHHHHHHHC CS
         Homeobox   1 rrkRttftkeqleeLeelFeknrypsaeereeLAkklgLterqVkvWFqNrRakekk 57 
                      +r+R  ++++ ++ L+++F+ +  +s++e +e+++  g+t +qV+ +F  ++++ +k
  Thhalv10028403m  67 KRPRDLLNPKAVKYLQAVFAIKDAISKKESREISALFGITVAQVRDFFVTQKTRVRK 123
                      799*********************************************999999886 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
PROSITE profilePS500719.60464124IPR001356Homeobox domain
SMARTSM003891.5E-466128IPR001356Homeobox domain
SuperFamilySSF466897.7E-667129IPR009057Homeodomain-like
Gene3DG3DSA:1.10.10.606.4E-567126IPR009057Homeodomain-like
CDDcd000867.27E-467124No hitNo description
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0009911Biological Processpositive regulation of flower development
GO:0010228Biological Processvegetative to reproductive phase transition of meristem
GO:0005634Cellular Componentnucleus
GO:0003677Molecular FunctionDNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 920 aa     Download sequence    Send to blast
MDDAFKEEIE IGSSVESLME LLDSQKELFH SQIDQLQDVV VTQCKLTGVN PLAQEMAAGA  60
LSIKIGKRPR DLLNPKAVKY LQAVFAIKDA ISKKESREIS ALFGITVAQV RDFFVTQKTR  120
VRKQVRLSRE KVIMSSTNDA LQDNGVPENN TRTHVDPVPL NSTYPEASSI SCGEGETVAL  180
MPPDDIPPDL SDSEKYFVEN IFSLLRKEET FSGQVKLMEW IMQIQDSSAL IWFLSKGGVL  240
ILTTWLSQAA IEEQTSVLLL ILKVLCHLPL HKASPENMSA ILQSVNGLRF YRIPGISNRA  300
KGLLSRWTKL FAKIQAMKKQ KCNSSQIDSQ SQMLLKQSIA EIMGDNSNPE DILSLSNGRS  360
ENVRNLKSSQ GPKLLLTSAD DSTKKHMLGS TPSYNKERRK VQMVEQPGQK AAGRSPQTVR  420
IGTSSRSRPM SADDIQKAKM RALYMHGKNS KKDPLPSAIG DSRTVVPEKP LALESAKDSP  480
LSQCTEAKAE DTPEPSAVQP VNSPAVNVPV QADEFRKPST PPKSISSKVG VLLKMSPQTI  540
LKNCKRKQID WHVPPGMELD EVWRVAAGGN SKEADVQKNR NRREKETTYQ SLQAIPLNPK  600
EPWDREMDFD DSLTPEIPTQ QPPEESITEP QDSLDERRTA AGAATTSSSR SSSMEPDFEL  660
LAALLKNPDL LYALTSGKPG SLAGQDMVKL LDVIKNGAPN SSCSSNYKVE EKVEVSLPSP  720
TPSTNPGMSG WGQEVIRNPF SRQNQVGAAV ARLSTQLPVA SMQWQSSNEQ LITRHAPSAY  780
NSLTLPHTER QQLHQQQSMQ PRLHQSQHLQ QQQQQPISTT SYAVRESIGQ MGTANSVSWR  840
SQQSQNSYYP HRANGIGSAS SYQGNEQPYI CSSSNPGFES WSPDHSPTRN HPNMRGQQQP  900
TRKYDSSSHP YWNQNKRWR*
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Nucleotide ? help Back to Top
Source Hit ID E-value Description
GenBankAK2267460.0AK226746.1 Arabidopsis thaliana mRNA for luminidependens protein, complete cds, clone: RAFL07-75-C15.
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_006396467.10.0hypothetical protein EUTSA_v10028403mg
SwissprotQ387960.0LUMI_ARATH; Homeobox protein LUMINIDEPENDENS
TrEMBLV4KJ890.0V4KJ89_EUTSA; Uncharacterized protein
STRINGscaffold_604015.10.0(Arabidopsis lyrata)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
MalvidsOGEM108762428
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT4G02560.20.0HB-other family protein